PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla020397
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family CO-like
Protein Properties Length: 374aa    MW: 42258.6 Da    PI: 6.2841
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla020397genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box29.12.1e-091760340
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
               +r C+ + +k+++++C  ++ +lC+ C  + H+       H++v
  Cla020397 17 ARACDSCISKRARWYCAADDAFLCQACDASVHSAnslarrHERV 60
               578*****************************657788888876 PP

2CCT67.44e-23319362144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                Rea+++RY+eKr+tR+F KkirYe+RK +Ae+RpR+KGrFvk++
  Cla020397 319 REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRS 362
                9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003369.8E-111562IPR000315B-box-type zinc finger
PROSITE profilePS5011910.9641562IPR000315B-box-type zinc finger
PfamPF006431.3E-71760IPR000315B-box-type zinc finger
CDDcd000219.49E-111862No hitNo description
PfamPF062038.1E-18319361IPR010402CCT domain
PROSITE profilePS5101715.993319361IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MTTRKSVEKT AEGGKTARAC DSCISKRARW YCAADDAFLC QACDASVHSA NSLARRHERV  60
RLQTASFRPS SDNSAASWHQ GFTKKPRSPR MGKTAPARKP FPQVPEVSAK EETEDQEQLL  120
LHRVPVLGAD SKDDFVWESL LGNSLDNECF DMEELGLAAS KDHSMTNDDH SLNSCELIKI  180
EADEVEELTP MLGTEADTMR EPFELNFMDF SSNPTTCSEE EKVMMEVMAA VKNGEVEMEE  240
TKIVKNKKKI SLSLDSEAVI IAWGSRGTPW TSGDRPNLDL DYYWPDYMGV CESDYYYQTY  300
GEFGGGIGRQ AVAGVEGERE ARVSRYREKR RTRLFAKKIR YEVRKLNAEK RPRMKGRFVK  360
RSSCFAPPPL PLIN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1329345RRTRLFAKKIRYEVRKL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818961e-175LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
GenBankLN7132641e-175LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004135402.20.0PREDICTED: zinc finger protein CONSTANS-LIKE 6-like
TrEMBLA0A0A0KWF40.0A0A0A0KWF4_CUCSA; Uncharacterized protein
STRINGVIT_01s0011g03520.t011e-107(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68520.11e-80B-box type zinc finger protein with CCT domain